PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK24486.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 247aa    MW: 28307.8 Da    PI: 5.0173
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK24486.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS190.21.4e-583245128374
       GRAS 128 LlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserd 225
                L+qaLas    ++   l+iT+vg    + + ++eetgerL +fA+++++p++f+++++ +++ l+ + ++++ +E++aV ++++l  +l+e+ +le+   
  PK24486.2   3 LMQALASSCheSQLELLKITAVGT---SARSAIEETGERLLSFAKTMNIPLSFKIVMVPDMSHLKEDLFELDCNETVAVYSSYSLRIFLSEPDQLEH--- 96 
                9*****7653377779********...4699************************9999******************************88888888... PP

       GRAS 226 evLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFk 325
                 ++k+v++l+P v+v++e e +hns+ F++rf+eal +y ++fd++e+ + r++ +r+  E+ +  ++i+n+va+eg+er+ r  +   Wr+ + ++G++
  PK24486.2  97 -LMKVVRNLNPCVMVLIEMEGNHNSPVFVNRFVEALFFYGTMFDCFETCMERNDPNRMLFEATYCFEAIRNIVATEGEERKIRIVKIDVWRAFFARFGME 195
                .*************************************************************************************************** PP

       GRAS 326 pvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                +++ls +   qa+l+  +++ +   ++e + ++l++gWk+ p+ s+S+Wr
  PK24486.2 196 ELELSPSSIYQANLIADRFPsGTHCNLEINGKCLMMGWKGTPVQSLSVWR 245
                ********************87889999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098527.5751224IPR005202Transcription factor GRAS
PfamPF035144.8E-563245IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
TVLMQALASS CHESQLELLK ITAVGTSARS AIEETGERLL SFAKTMNIPL SFKIVMVPDM  60
SHLKEDLFEL DCNETVAVYS SYSLRIFLSE PDQLEHLMKV VRNLNPCVMV LIEMEGNHNS  120
PVFVNRFVEA LFFYGTMFDC FETCMERNDP NRMLFEATYC FEAIRNIVAT EGEERKIRIV  180
KIDVWRAFFA RFGMEELELS PSSIYQANLI ADRFPSGTHC NLEINGKCLM MGWKGTPVQS  240
LSVWRFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-221245125375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097792.11e-120hypothetical protein L484_004206
TrEMBLW9R5C51e-120W9R5C5_9R
STRINGPOPTR_0010s15370.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-36RGA-like 2